Protein coding transcript 130746

• Transcript: Ll_transcript_117387
• CDS coordinates: 3-371 (+)
• Peptide sequence: KVQLLLLHALNYRNQLLNIFCTLLMENGGCSRKPVKIVIINTQYVETDATNFKSVVQKLTGKHSCYDDVAARKAKRVRHNVVVSGVEVPCSSDAGHGSSFSLSDFDMFLSEMPLINDNLWSH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_117387

• Blastp: VQ motif-containing protein 1 from Arabidopsis with 36.84% of identity
• Blastx: VQ motif-containing protein 10 from Arabidopsis with 62.16% of identity
• Eggnog: BEST Arabidopsis thaliana protein match is VQ motif-containing protein (TAIR AT1G78410.1)(ENOG41106Q9)
• Kegg: Link to kegg annotations (AT1G17147)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432375.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;