Protein coding transcript 130749

• Transcript: Ll_transcript_117385
• CDS coordinates: 1-309 (+)
• Peptide sequence: AEELEFVSHHVRTKLDEIKRLELERLKDLVEQKRKLLDTNAIDVEDPTHHHIDHSNPHTFEIEDLKKLIHKTTADLAEADKLRRNEFKEYELQKEFEKQDKLN
• ORF Type: internal

Annotations of Ll_transcript_117385

• Blastp: Nucleobindin-2 from Mus with 43.12% of identity
• Blastx: Nucleobindin-2 from Mus with 43.12% of identity
• Eggnog: Nucleobindin(ENOG410XW7D)
• Kegg: Link to kegg annotations (53322)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020963541.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;