| Transcript | Ll_transcript_251124 |
|---|---|
| CDS coordinates | 2-346 (+) |
| Peptide sequence | KNSSCMAEFNYEKSPVVYKLPLRSCNTMSTYLNDGLVEYFNTIVLQPHRKLVTNQGKGFHIRCKYQTNDQLLTNVLNMSTTDEAAMIETAKMPTCTMKIFSGKTVKQDVAENVKI |
| ORF Type | internal |
| Blastp | Cuticlin-1 from Caenorhabditis with 29.35% of identity |
|---|---|
| Blastx | Cuticlin-1 from Caenorhabditis with 29.35% of identity |
| Eggnog | ZP(ENOG4111EBZ) |
| Kegg | Link to kegg annotations (CELE_C47G2.1) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_006596860.1) |
| Pfam | Zona pellucida-like domain (PF00100.22) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer