Protein coding transcript 130760

• Transcript: Ll_transcript_251134
• CDS coordinates: 35-385 (+)
• Peptide sequence: MASQTQGIQQLLAAEKRAAEKVSEARKRKARRLKQAKEEAQDEIEKYRKDRERQFREFEAKHMGSREDVASKIETDTKQRIEDMNKAIISQKAPVITEVLALVYDIKPEMHKNYRN*
• ORF Type: complete

Annotations of Ll_transcript_251134

• Blastp: V-type proton ATPase subunit G from Manduca with 75.65% of identity
• Blastx: V-type proton ATPase subunit G from Manduca with 75.65% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017417777.1)
• Pfam: Vacuolar (H+)-ATPase G subunit (PF03179.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;