Protein coding transcript 130762

• Transcript: Ll_transcript_216743
• CDS coordinates: 99-881 (+)
• Peptide sequence: MALLCGSTSLTFPSTSLSSQFKNATSKSSSFSSFHFSLPNLSLSSSSSLSYSFQTQFPSTNFSLHSQLQEQEPELELEQEEEEEVENDPRFMCVEPEPRFSGPDIWNTTWYPKAADHVNTEKTWYVVDATDKVLGRLASTIAIHIRGKNLATFTPSVDMGAFVIVVNAEKVAVSGKKRTQKVYRRHSGRPGGMTVETFAQLQNRIPERIIEHAVRGMLPKGRLGRRLFTHLKVYKGPEHPHAAQKPIDLPIKDKRIQLVR*
• ORF Type: complete

Annotations of Ll_transcript_216743

• Blastp: 50S ribosomal protein L13, chloroplastic from Arabidopsis with 82.18% of identity
• Blastx: 50S ribosomal protein L13, chloroplastic from Arabidopsis with 84.02% of identity
• Eggnog: This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages of 50S assembly (By similarity)(COG0102)
• Kegg: Link to kegg annotations (AT1G78630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413784.1)
• Pfam: Ribosomal protein L13 (PF00572.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;