Protein coding transcript 130763

• Transcript: Ll_transcript_216728
• CDS coordinates: 2-472 (+)
• Peptide sequence: VILPTEEELTVPEINLSGPALKAGAFHLGKACENQNNEFMLCRNELGDPRKCINEGKAVTNCAMNFFRQIKKTCSGEFMQYVNCLDKSSPDQAFNPCRKTQAVLDKCVKDNLGIDRPPYDYYTRVHVHKTARPRLPVEGPTVYEDATPRLPEDIPKP
• ORF Type: internal

Annotations of Ll_transcript_216728

• Blastp: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 from Mus with 51.13% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 from Mus with 51.13% of identity
• Eggnog: NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex(ENOG4111IST)
• Kegg: Link to kegg annotations (68375)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431475.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;