Protein coding transcript 130767

• Transcript: Ll_transcript_216708
• CDS coordinates: 3-332 (+)
• Peptide sequence: TTTTTMAEGEPIRVVVTGAAGQIAYSLISMIANGDVFGTKQPVILHLLDIPPAMGVLEGVCMEIDDLALPLVKGYVKTTEPEVAFKDVDAAFLVGAMPRREGMERKDLLS
• ORF Type: internal

Annotations of Ll_transcript_216708

• Blastp: Malate dehydrogenase, cytoplasmic from Gallus with 70.3% of identity
• Blastx: Malate dehydrogenase, cytoplasmic from Gallus with 70.3% of identity
• Eggnog: Catalyzes the reversible oxidation of malate to oxaloacetate (By similarity)(COG0039)
• Kegg: Link to kegg annotations (421281)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020203287.1)
• Pfam: lactate/malate dehydrogenase, NAD binding domain (PF00056.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;