Protein coding transcript 130770

• Transcript: Ll_transcript_107429
• CDS coordinates: 2-826 (+)
• Peptide sequence: PPKQTKPGDKAGAKPEDKKKKPAAAAGAASGSAAKPAKAKPAAKDGKPKPAKDGKPKPAKGADKKVAKGADKKGAAKPAKGAAKGAKVPVKGAKKPVVKGATKPAKGAAKGAKAALPLTGRRAPKGGAIKAAKAALEKARKVQKKVIKGPNGTRVRKVRTSVHFRRPKTFKAPRNPRYPRKSVPTRNRMDAFNIIKYPLTTEAAMKKIEDNNTLVFLVHLRANKHHIKAAVKKLYDIDVAKVNTLIRPDGKKKAYVRLTRDFDALDSANKIGII*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_107429

• Blastp: 60S ribosomal protein L23a from Rattus with 71.43% of identity
• Blastx: 60S ribosomal protein L23a from Rattus with 70.49% of identity
• Eggnog: One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome (By similarity)(COG0089)
• Kegg: Link to kegg annotations (360572)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014494213.1)
• Pfam: Ribosomal protein L23, N-terminal domain (PF03939.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;