Protein coding transcript 130772

• Transcript: Ll_transcript_216723
• CDS coordinates: 1-468 (+)
• Peptide sequence: GGGFSNTGGGNYGGNAGGYGGGPGGYGNNVGSGNFGGGGGGGYGGGFDDGPMSDFSMPPPAMGAGAGKPAAFNGSTQVTIPKDLAGAIIGKAGARIRRIRQDSGAGITIGEPTEGSDERIITINGTDSQIQMAQYLLQQCVQAQKPGGPGGDGFM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_216723

• Blastp: Heterogeneous nuclear ribonucleoprotein K from Gallus with 69.12% of identity
• Blastx: Heterogeneous nuclear ribonucleoprotein K from Gallus with 69.12% of identity
• Eggnog: heterogeneous nuclear ribonucleoprotein k(ENOG4111GSB)
• Kegg: Link to kegg annotations (426516)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006594666.1)
• Pfam: KH domain (PF00013.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;