Protein coding transcript 130776

• Transcript: Ll_transcript_187485
• CDS coordinates: 1-480 (+)
• Peptide sequence: SRTCLGVIEVVMTTSQLNYRLELESVCKALEDVDLRSSKLSSIQDFKACHKSYEAVLPEIREVFRSACEMHKLPLAQTWIPCIQQGKEGCRHSEDNYLHCISPVEHACYVNDPSIRAFHDACSEHHLLKGQGVAGGAYLTNQPCFSSDITSLSKTDYPLS
• ORF Type: internal

Annotations of Ll_transcript_187485

• Blastp: Protein NLP4 from Arabidopsis with 63.12% of identity
• Blastx: Protein NLP4 from Arabidopsis with 63.12% of identity
• Eggnog: RWP-RK domain-containing protein(ENOG41129QX)
• Kegg: Link to kegg annotations (AT1G20640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438098.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;