Protein coding transcript 130777

• Transcript: Ll_transcript_187520
• CDS coordinates: 291-911 (+)
• Peptide sequence: MDINVNEDHNEQNLPLLGNKEVPETERNLIQRTISQTFQSTAHLANLLPTGTVLAFQLLSPIFTNLGNCDSVSKFMTAALVAISGASCFLLCFTDSFRDSKGNICYGFATFRGLWVIDGSTTLPPQLAAKYRIRVVDFMHAVMSVMVFAAIALFDQNVVNCFFPEPSNETQEILTVLPVGIGVFSSMLFVTFPTQRHGIGFPLSTN*
• ORF Type: complete

Annotations of Ll_transcript_187520

• Blastp: Protein DMP4 from Arabidopsis with 62.91% of identity
• Blastx: Protein DMP4 from Arabidopsis with 62.91% of identity
• Eggnog: Protein of unknown function (DUF679)(ENOG410YAMB)
• Kegg: Link to kegg annotations (AT4G18425)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424851.1)
• Pfam: Protein of unknown function (DUF679) (PF05078.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;