Transcript | Ll_transcript_187493 |
---|---|
CDS coordinates | 2-1027 (+) |
Peptide sequence | AVPQVVSLESMPYLVNGKIDRQTLLRQYSEISVSDNLKESKIDFTDIDASQMETAKHLFETVSCVLGSSLRSHISPTANFFALGGNSLNAIYTISKLADLGYSIAVSDFITAPNFGIVINKMRFSGKRKACCKDEEWLSEKYTRQMLEPKHKDDVIKIIADSFYEKADLEHWIVPKVPYSEYTDVLELLWEPLLEKNLSFVVQSKESDRLMGAALNFDALDEPDIEFNGRLTVIFEFLESLEGPIRRDYLPKSKGSILHSFMMGTDNTLDAATNVEVITYMEQEVLQLGKTNGFEGIFTTNTNPLTQQLGANVFGYKILHDCQINSYVTPDGNKIFGEAPDD |
ORF Type | internal |
Blastp | Nonribosomal peptide synthetase vlms from Lecanicillium with 31.47% of identity |
---|---|
Blastx | Nonribosomal peptide synthetase vlms from Lecanicillium with 31.47% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004516134.1) |
Pfam | Phosphopantetheine attachment site (PF00550.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer