Protein coding transcript 130781

• Transcript: Ll_transcript_187519
• CDS coordinates: 3-401 (+)
• Peptide sequence: FCILRKRHSGTFKMVDEDEKTKVLRKAFQMFDQTKSGFIETHKIATILNTIGQLFDESELNSLISRNDPDKSGKVDFDSFCEIASHFLEEDDDDPTQELKEAFRLYDREGNGYITTGTLKEILAALDDNLNSR
• ORF Type: internal

Annotations of Ll_transcript_187519

• Blastp: Troponin C, isoform 2 from Sophophora with 50.41% of identity
• Blastx: Troponin C, isoform 2 from Sophophora with 50.41% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (Dmel_CG9073)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001236109.1)
• Pfam: EF hand (PF13202.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;