Protein coding transcript 130783

• Transcript: Ll_transcript_175540
• CDS coordinates: 3-464 (+)
• Peptide sequence: RFQDNFEFLQWFKKFFDTNYQMNDYDPVGARSGEGMGAAGAAARAGPVKKPSAAVPPRNATTQNRLFRPASNSNMSNRVPTTRPAAPANQRDRGDHKIEELTRQMSELRVTVDGLEKERDFYFGKLRDIEMICQEQESEHPLFSKVLEILYATE
• ORF Type: internal

Annotations of Ll_transcript_175540

• Blastp: Microtubule-associated protein RP/EB family member 1 from Silurana with 47.5% of identity
• Blastx: Microtubule-associated protein RP/EB family member 3 from Rattus with 44.24% of identity
• Eggnog: microtubule-associated protein RP EB family member(COG5217)
• Kegg: Link to kegg annotations (394720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003517319.1)
• Pfam: EB1-like C-terminal motif (PF03271.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;