Protein coding transcript 130787

• Transcript: Ll_transcript_175541
• CDS coordinates: 143-556 (+)
• Peptide sequence: MLSLKLFRRLNKPLLAAPMMARFTGSAAAVKTGKNYASHWRTERIVSIALMGLFPASVLYSSQIVDTLLAGSISLHVYWGLEALVVDYLRVPVVGQLANKAGHAAITLLAIVTLAGFLQVIFVGDGLGNAIVTLWKL*
• ORF Type: complete

Annotations of Ll_transcript_175541

• Blastp: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial from Sophophora with 36.29% of identity
• Blastx: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial from Sophophora with 32.91% of identity
• Eggnog: succinate dehydrogenase(ENOG4111RTW)
• Kegg: Link to kegg annotations (Dmel_CG10219)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016191591.1)
• Pfam: CybS, succinate dehydrogenase cytochrome B small subunit (PF05328.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;