Protein coding transcript 130788

• Transcript: Ll_transcript_175534
• CDS coordinates: 2-442 (+)
• Peptide sequence: TNEANIYKLIIAEIFPEDSGAYTCEAFNDAGESFSSCTLNVIVAGEQPKSPVFKTFPVSATVSEGESATFEAETEDNPLQINWLKDGKAIKETSAKYKFTADGKRYTLEIVSCDSNDVGQYQAKAIGKKGETFAAFSLNVVPSGEL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_175534

• Blastp: Myosin light chain kinase, smooth muscle from Mus with 31.62% of identity
• Blastx: Myosin light chain kinase, smooth muscle from Mus with 31.62% of identity
• Eggnog: myosin light chain kinase(ENOG410XQFD)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014633283.1)
• Pfam: Immunoglobulin I-set domain (PF07679.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;