Protein coding transcript 130796

• Transcript: Ll_transcript_175549
• CDS coordinates: 2-457 (+)
• Peptide sequence: TGLVWAKAGTKPSGGPPPPPPPCGLPPMDDLCLAPSDPDATNRSALFAEINRGTDVTKSLKKVSPDMQTHKNPSMRASGPAPAVIGNSSGVSAPKPAVEKPPVFARDGKKWLVENQKNNTNLVVDGAEMNNVVYIFKCVNSTITVKNKINSI
• ORF Type: internal

Annotations of Ll_transcript_175549

• Blastp: Adenylyl cyclase-associated protein 1 from Mus with 50.41% of identity
• Blastx: Adenylyl cyclase-associated protein 1 from Mus with 50.41% of identity
• Eggnog: adenylyl cyclase-associated protein(ENOG410XPXJ)
• Kegg: Link to kegg annotations (12331)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004507425.1)
• Pfam: Adenylate cyclase associated (CAP) N terminal (PF01213.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;