Protein coding transcript 130797

• Transcript: Ll_transcript_175524
• CDS coordinates: 193-681 (+)
• Peptide sequence: METITNSISSVQQKIPTKKRIKPMKQKSKPIKIVYISNPMRVKTSVSEFRTLVQELTGKDAEMQPDPSRYCWEGDSSGYKILVSDEDCVKKNGDDENDSQVEEVHNVEVEKCVEVSSSMDYFDDVFTPQMIENISAFLPDCVFCECARVDHKVLMECNFIHK*
• ORF Type: complete

Annotations of Ll_transcript_175524

• Blastp: Sigma factor binding protein 1, chloroplastic from Arabidopsis with 56.67% of identity
• Blastx: Sigma factor binding protein 1, chloroplastic from Arabidopsis with 56.67% of identity
• Eggnog: Sigma factor binding protein(ENOG410ZFI0)
• Kegg: Link to kegg annotations (AT3G56710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006576783.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;