Transcript | Ll_transcript_175544 |
---|---|
CDS coordinates | 47-1153 (+) |
Peptide sequence | MASFSSLLFQTLILFAVISAVTPCPPSDRAALLAFRAALTEPYMGIFNSWSGYNCCQGWYGVTCDPTTYRVTDITLRGDPSEKNLQNLRRSSGFMTGNISPEICNMDNLTTLVVADWKSISGEIPSCITSLSLIRILDLSGSQISGNIPVDIGKLQRLAVLNLGDNAISGEIPASIVDLAGLMHLDLANNKISGELPTDFGKLSMLSRALLSQNNLTGSIPNSISQMNRLADLDLSMNRFTGSIPVEFGQMKVLSILKLDSNSLSGQIPSTLLNNAGMGILNLSRNGFEGTIPDVFCAKSYFMALDLSFNKLAGRIPGSLSATRFIGHLDVSHNHLCGTIPIGAPFDHLDEVSFSNNDCLCGNPLKTC* |
ORF Type | complete |
Blastp | DNA damage-repair/toleration protein DRT100 from Arabidopsis with 59.71% of identity |
---|---|
Blastx | DNA damage-repair/toleration protein DRT100 from Arabidopsis with 59.71% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT3G12610) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451464.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer