Protein coding transcript 130805

• Transcript: Ll_transcript_108402
• CDS coordinates: 539-1006 (+)
• Peptide sequence: MDMRKALLTEFHVTPSAHHSGVKPTLARLATSFYRPSIYKDTVLFIRQCLICQQSKYSTMAKQGLQPLSIPHQVWEDISMDFITHLPVTCGHTVILVIVDRLTKFAHFVALPTHFAAAQLANCFAMDILPPAWDSQVYCVRSGSSVHEPILEGVL*
• ORF Type: complete

Annotations of Ll_transcript_108402

• Blastp: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 43.27% of identity
• Blastx: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 36.08% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YIL082W-A)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450597.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;