Protein coding transcript 130817

• Transcript: Ll_transcript_19461
• CDS coordinates: 3-494 (+)
• Peptide sequence: LGAPVVGGAGARVNGLVGTIIGLDPAYPLVIYDHLDARLDTTDGEFVQVIHTCAGFLGMKKVVGHVDYFPNGGSAQPGCFLDLAGSCSHGRSFEFYAESILDNKFVSVECKDEFYFKVNKCNNNLRSLMGGYMDQIDKEANGTFYLNTNDEEPWGLGDIYSSL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_19461

• Blastp: Pancreatic triacylglycerol lipase from Oryctolagus with 39.44% of identity
• Blastx: Pancreatic triacylglycerol lipase from Oryctolagus with 38.51% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100009157)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020206757.1)
• Pfam: Lipase (PF00151.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;