Protein coding transcript 130820

• Transcript: Ll_transcript_19479
• CDS coordinates: 1-528 (+)
• Peptide sequence: DSTVSRSSHAGGGDQEPLIEQAETTELLSEPEEPAPGTGVLGSIQLTLTFSVARQRLNVTIHKVVNLPIKEASDIPDPYVKLYVLPKKENSNTKRKTETYKDNCNPVYEETFEYIMGVAELNSKQLEVTVLTKKTWHSPVLGQIVLNISDYVNVNTPSFTGWFDLETEVKEGTVG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_19479

• Blastp: Extended synaptotagmin-2-B from Xenopus with 41.49% of identity
• Blastx: Extended synaptotagmin-2-B from Xenopus with 41.49% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (380278)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431471.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;