Protein coding transcript 130822

• Transcript: Ll_transcript_121277
• CDS coordinates: 3-314 (+)
• Peptide sequence: GIWVSNHGARQVDGTPASIEALPEIVQAVQGKAEIYLDGGIRDGTDVFKAIAMGARMVFMGRPALWGLTQGGQEGVENILKIIKNEFEHTMAISGNMYFLNFL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_121277

• Blastp: Hydroxyacid oxidase 1 from Mus with 62.11% of identity
• Blastx: Hydroxyacid oxidase 1 from Homo with 62.11% of identity
• Eggnog: Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its allylic isomer, dimethylallyl diphosphate (DMAPP) (By similarity)(COG1304)
• Kegg: Link to kegg annotations (15112)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014633831.1)
• Pfam: FMN-dependent dehydrogenase (PF01070.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;