Protein coding transcript 130826

• Transcript: Ll_transcript_174675
• CDS coordinates: 2-301 (+)
• Peptide sequence: LKIIGNRLNGNLSNEIGRLPMLDVLDLSNNNITGEVPASLFNISTLRVINLRDNLFVGQLPQKMCQNSPLLQQFNLTNNKVGGIIPTSISNCTSLKSLLM
• ORF Type: internal

Annotations of Ll_transcript_174675

• Blastp: LRR receptor-like serine/threonine-protein kinase GSO1 from Arabidopsis with 38.78% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase GSO1 from Arabidopsis with 38.78% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G20140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418416.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;