Protein coding transcript 130828

• Transcript: Ll_transcript_174695
• CDS coordinates: 1-345 (+)
• Peptide sequence: ARNIIVVIVSACLAYYFDQHEEKPFRLIGYVKPGLPTLQPPPFSTTVGNKTYSFTEMTTTLGGGIIVVPLLAILENISLAKVFSEGNRVDATQEMIALGACNIISSFVSSMPITG
• ORF Type: internal

Annotations of Ll_transcript_174695

• Blastp: Sodium-independent sulfate anion transporter from Mus with 47.86% of identity
• Blastx: Sodium-independent sulfate anion transporter from Mus with 47.86% of identity
• Eggnog: sulfate transporter(COG0659)
• Kegg: Link to kegg annotations (268512)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003590594.1)
• Pfam: Sulfate permease family (PF00916.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;