| Transcript | Ll_transcript_22766 |
|---|---|
| CDS coordinates | 10-315 (-) |
| Peptide sequence | LTKLGSPRGEVGEIDTRAPFQSVKAAVSLFGEVAVSRDRFSVNRRSSEVIIKPYFSYQYIILLPRKHLCMLIMEMDYLNVSLVICRVYLKRKHSLSWHKDN* |
| ORF Type | 5prime_partial |
| Blastp | WEB family protein At1g12150 from Arabidopsis with 83.33% of identity |
|---|---|
| Blastx | WEB family protein At1g12150 from Arabidopsis with 83.33% of identity |
| Eggnog | Pfam:DUF827(ENOG410ZHIN) |
| Kegg | Link to kegg annotations (AT1G12150) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019434943.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer