Protein coding transcript 130835

• Transcript: Ll_transcript_36468
• CDS coordinates: 2-349 (+)
• Peptide sequence: GDITLGELLKKKASEGVRVLILVWNDRTSVHLLKKDGLMATHDEETGKFFSGTDVNCVLCPRNPDNGSSIIQDLQISTMFTHHQKIVVVDSELPSGDSDRRRIVSFVGGIDLCDGR
• ORF Type: internal

Annotations of Ll_transcript_36468

• Blastp: Phospholipase D alpha 1 from Ricinus with 85.34% of identity
• Blastx: Phospholipase D alpha 1 from Ricinus with 85.34% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8282326)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445206.1)
• Pfam: Phospholipase D Active site motif (PF00614.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;