Transcript | Ll_transcript_47796 |
---|---|
CDS coordinates | 34-342 (+) |
Peptide sequence | MGGHGHGHGDPYKIPDYRIYKVADVPELASIEKALASQGLKDPWLRNEVWRYNVKEFGNEKIRIKQVFFRGFKYGFGAFLLTIAGTAIYDKLNPSDHGHGHH* |
ORF Type | complete |
Blastp | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 from Pongo with 40.21% of identity |
---|---|
Blastx | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 from Pongo with 41.76% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013469851.1) |
Pfam | NADH-ubiquinone oxidoreductase B12 subunit family (PF08122.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer