Protein coding transcript 130845

• Transcript: Ll_transcript_47797
• CDS coordinates: 37-345 (+)
• Peptide sequence: MGGHGHGHGDPYKIPDYRIYKVADVPELASIEKALASQGLKDPWLRNEVWRYNVKEFGNEKIRIKQVFFRGFKYGFGAFLLTIAGTAIYDKLNPSDHGHGHH*
• ORF Type: complete

Annotations of Ll_transcript_47797

• Blastp: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 from Pongo with 40.21% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 from Pongo with 41.76% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016162900.1)
• Pfam: NADH-ubiquinone oxidoreductase B12 subunit family (PF08122.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;