Protein coding transcript 130849

• Transcript: Ll_transcript_47819
• CDS coordinates: 1-438 (+)
• Peptide sequence: TLQDGGMELANQQWGFHKVNPTEQWYPGISEIRDQLQGWEWCYGKTPKFTVSRSFAVPDRLTCSGPEDLKITLTVESGLIADVSLYVPPGLSSSGFAGEANVITHLKGQRFEEEVFNNLELSLGGLVNDRDKFVTECLKQVVTSV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_47819

• Blastp: Lipoyltransferase 1, mitochondrial from Homo with 37.84% of identity
• Blastx: Lipoyltransferase 1, mitochondrial from Homo with 37.84% of identity
• Eggnog: Lipoate-protein, ligase(COG0095)
• Kegg: Link to kegg annotations (51601)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003524764.1)
• Pfam: RtxA repeat (PF07634.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;