Transcript | Ll_transcript_47819 |
---|---|
CDS coordinates | 1-438 (+) |
Peptide sequence | TLQDGGMELANQQWGFHKVNPTEQWYPGISEIRDQLQGWEWCYGKTPKFTVSRSFAVPDRLTCSGPEDLKITLTVESGLIADVSLYVPPGLSSSGFAGEANVITHLKGQRFEEEVFNNLELSLGGLVNDRDKFVTECLKQVVTSV* |
ORF Type | 5prime_partial |
Blastp | Lipoyltransferase 1, mitochondrial from Homo with 37.84% of identity |
---|---|
Blastx | Lipoyltransferase 1, mitochondrial from Homo with 37.84% of identity |
Eggnog | Lipoate-protein, ligase(COG0095) |
Kegg | Link to kegg annotations (51601) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003524764.1) |
Pfam | RtxA repeat (PF07634.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer