| Transcript | Ll_transcript_150934 |
|---|---|
| CDS coordinates | 3-347 (+) |
| Peptide sequence | WNTDDEDEVFGITSSIPSIIQESCGHNLLVSSSTCTCTKQGKLILHFVGMGFSKDQVIKAIEENVVGEENEEDILETLLTLTTLTENSFNFERDKILTVLVNMEYPIEEALIAIE |
| ORF Type | internal |
| Blastp | DNA (cytosine-5)-methyltransferase DRM1 from Arabidopsis with 30.07% of identity |
|---|---|
| Blastx | - |
| Eggnog | DNA (cytosine-5-)-methyltransferase(ENOG410XQ4Y) |
| Kegg | Link to kegg annotations (AT5G15380) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422938.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer