| Transcript | Ll_transcript_52467 |
|---|---|
| CDS coordinates | 78-479 (+) |
| Peptide sequence | MSGVWVFEKNGVARLISNPTRESFEHKHTPHSSGTPTAPGARPRQLLFLPTNQVITSHSQLQHTLAQLGWTRYHNSDNPHLIQFHRSQNSTHLISLPKTFSDIKHFHMYDIVIKNPSFFQVRNPMSSVSKHQP* |
| ORF Type | complete |
| Blastp | Flowering-promoting factor 1-like protein 1 from Arabidopsis with 47.58% of identity |
|---|---|
| Blastx | Flowering-promoting factor 1-like protein 1 from Arabidopsis with 47.58% of identity |
| Eggnog | positive regulation of flower development(ENOG4112CDX) |
| Kegg | Link to kegg annotations (AT4G31380) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003542029.2) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer