Protein coding transcript 130856

• Transcript: Ll_transcript_52470
• CDS coordinates: 1-492 (+)
• Peptide sequence: ITSQQEIMDLILSCTIENKILPKLETQNSVSYSENHTLKAVLVASLYPDYGESLRAMYLNKASVNGELIGVFQPSHEQQQKFHDNMHDMKAWTEMYLLSLSDVLVTTSLSTFGYVAQGLGGLKPWLLYRLTSNAHYFPACVRDFSIEPCNHIPPKHFCNGEPIK
• ORF Type: internal

Annotations of Ll_transcript_52470

• Blastp: Putative fucosyltransferase 10 from Arabidopsis with 49.04% of identity
• Blastx: Putative fucosyltransferase 10 from Arabidopsis with 49.04% of identity
• Eggnog: fucosyltransferase(ENOG410XXHE)
• Kegg: Link to kegg annotations (AT2G15350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414981.1)
• Pfam: Xyloglucan fucosyltransferase (PF03254.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;