Transcript | Ll_transcript_52470 |
---|---|
CDS coordinates | 1-492 (+) |
Peptide sequence | ITSQQEIMDLILSCTIENKILPKLETQNSVSYSENHTLKAVLVASLYPDYGESLRAMYLNKASVNGELIGVFQPSHEQQQKFHDNMHDMKAWTEMYLLSLSDVLVTTSLSTFGYVAQGLGGLKPWLLYRLTSNAHYFPACVRDFSIEPCNHIPPKHFCNGEPIK |
ORF Type | internal |
Blastp | Putative fucosyltransferase 10 from Arabidopsis with 49.04% of identity |
---|---|
Blastx | Putative fucosyltransferase 10 from Arabidopsis with 49.04% of identity |
Eggnog | fucosyltransferase(ENOG410XXHE) |
Kegg | Link to kegg annotations (AT2G15350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414981.1) |
Pfam | Xyloglucan fucosyltransferase (PF03254.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer