Protein coding transcript 130857

• Transcript: Ll_transcript_52471
• CDS coordinates: 2-445 (+)
• Peptide sequence: ENNLLPKLDTQSSVSYSQNHTTKAILVTSLSPNYGENLKAMYQNKQSTSAEVIGVYQPSHEEEQKFHDNMHNIKAWTEMYLLSLSDVLVTTSLSTFGYVAQGLGGLKPWLLYRLTSNAHYFPACVRDFSIEPCNHIPPKHFCNGEPIK
• ORF Type: internal

Annotations of Ll_transcript_52471

• Blastp: Galactoside 2-alpha-L-fucosyltransferase from Pisum with 49.32% of identity
• Blastx: Galactoside 2-alpha-L-fucosyltransferase from Arabidopsis with 52.05% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414981.1)
• Pfam: Xyloglucan fucosyltransferase (PF03254.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;