Transcript | Ll_transcript_52471 |
---|---|
CDS coordinates | 2-445 (+) |
Peptide sequence | ENNLLPKLDTQSSVSYSQNHTTKAILVTSLSPNYGENLKAMYQNKQSTSAEVIGVYQPSHEEEQKFHDNMHNIKAWTEMYLLSLSDVLVTTSLSTFGYVAQGLGGLKPWLLYRLTSNAHYFPACVRDFSIEPCNHIPPKHFCNGEPIK |
ORF Type | internal |
Blastp | Galactoside 2-alpha-L-fucosyltransferase from Pisum with 49.32% of identity |
---|---|
Blastx | Galactoside 2-alpha-L-fucosyltransferase from Arabidopsis with 52.05% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414981.1) |
Pfam | Xyloglucan fucosyltransferase (PF03254.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer