Protein coding transcript 130870

• Transcript: Ll_transcript_66720
• CDS coordinates: 2-328 (+)
• Peptide sequence: SNVKQVQMFVLKEKKWARYLKLNLQTHYGSEFYCTLSIVEVYGVDAIERMLEDLIITKDNPNYAKGDDNVWKNGLRNINLNHASDVPIQVGRMPGDTVLKILMQKVHFL
• ORF Type: internal

Annotations of Ll_transcript_66720

• Blastp: SUN domain-containing protein 3 from Arabidopsis with 44.16% of identity
• Blastx: SUN domain-containing protein 3 from Arabidopsis with 44.16% of identity
• Eggnog: SUN domain containing ossification factor(ENOG41116S0)
• Kegg: Link to kegg annotations (AT1G22882)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435891.1)
• Pfam: Sad1 / UNC-like C-terminal (PF07738.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;