Protein coding transcript 130872

• Transcript: Ll_transcript_66711
• CDS coordinates: 58-660 (+)
• Peptide sequence: MDFRGIGFDPRMLDFLVDHIDFSDETDTKSHHAPSRAYVRDSKAMASTHADILDYPDAYKFVVDMPGLKSDQIKVTMEDDTLVLCGERRRDKEKDHKEGVKYLRMERRQGKFLKKFELPENANPDEICACYLDGVLTVTVRKKPPPEPKKPKTIQVQVNSPEPQSQSHAGGAIQDGQNQKSQSQENQDNAATQDSHDKRA*
• ORF Type: complete

Annotations of Ll_transcript_66711

• Blastp: 17.9 kDa class II heat shock protein from Soja with 59.01% of identity
• Blastx: 17.9 kDa class II heat shock protein from Soja with 59.01% of identity
• Eggnog: response to heat(COG0071)
• Kegg: Link to kegg annotations (100813195)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416317.1)
• Pfam: Hsp20/alpha crystallin family (PF00011.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;