| Transcript | Ll_transcript_70534 |
|---|---|
| CDS coordinates | 3-338 (+) |
| Peptide sequence | HGGVPVKGPPLALGVGPVGPSPPPRAVGKGLELGRVGERTSFTVSSVVQPRVQVETVEGNIDVHIQSPKTGEYIVSYTPKWVGTYDIIISIGPNDLPGSPFRPTIVDPSAVR |
| ORF Type | internal |
| Blastp | Filamin-C from Mus with 32.74% of identity |
|---|---|
| Blastx | - |
| Eggnog | Microtubule associated monoxygenase, calponin and LIM domain containing(COG5069) |
| Kegg | Link to kegg annotations (68794) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020979347.1) |
| Pfam | Filamin/ABP280 repeat (PF00630.18) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer