Protein coding transcript 130881

• Transcript: Ll_transcript_264915
• CDS coordinates: 1-330 (+)
• Peptide sequence: GMGPNAYLAFNMVGYHGTGTISYQTALAVFCIEGCAFLLASALGLRGKVAKLIPLSVRLACAAGIGLFIAFVGLQSNQGVGLIGPDPANLVTITACKITDPETGACPGGR
• ORF Type: internal

Annotations of Ll_transcript_264915

• Blastp: Adenine/guanine permease AZG2 from Arabidopsis with 69.09% of identity
• Blastx: Adenine/guanine permease AZG2 from Arabidopsis with 69.09% of identity
• Eggnog: Xanthine uracil vitamin C permease(COG2252)
• Kegg: Link to kegg annotations (AT5G50300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434021.1)
• Pfam: Permease family (PF00860.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;