Protein coding transcript 130882

• Transcript: Ll_transcript_264903
• CDS coordinates: 2-415 (+)
• Peptide sequence: FGKESKKKELIKNLGTIYEQIQREYQISPGDFPDLKKMQEQLAHHDFTKFQPLKIRLLEVVDKMLSDDIARLMAQIPQEEETYTIDQGNVKGGAFKNIEDTVSPFGYKRGEGVDAGAGEIEWVVNKDRSKYDAIFDTL
• ORF Type: internal

Annotations of Ll_transcript_264903

• Blastp: EH domain-containing protein 1 from Bos with 57.25% of identity
• Blastx: EH domain-containing protein 1 from Bos with 57.25% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (511908)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020982760.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;