Protein coding transcript 130886

• Transcript: Ll_transcript_73775
• CDS coordinates: 96-719 (+)
• Peptide sequence: MFCCCSYREDRGKGPMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRSDPSTINELKKMKQEPVKPQDGRSMAEKINAFAYLECSAKSKEGVREVFENATRAALQVKKKKKHRCVLF*
• ORF Type: complete

Annotations of Ll_transcript_73775

• Blastp: Ras-like GTP-binding protein Rho1 from Sophophora with 92.19% of identity
• Blastx: Ras-like GTP-binding protein Rho1 from Sophophora with 92.19% of identity
• Eggnog: GTP-binding Protein(COG1100)
• Kegg: Link to kegg annotations (Dmel_CG8416)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020969588.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;