Transcript | Ll_transcript_73775 |
---|---|
CDS coordinates | 96-719 (+) |
Peptide sequence | MFCCCSYREDRGKGPMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRSDPSTINELKKMKQEPVKPQDGRSMAEKINAFAYLECSAKSKEGVREVFENATRAALQVKKKKKHRCVLF* |
ORF Type | complete |
Blastp | Ras-like GTP-binding protein Rho1 from Sophophora with 92.19% of identity |
---|---|
Blastx | Ras-like GTP-binding protein Rho1 from Sophophora with 92.19% of identity |
Eggnog | GTP-binding Protein(COG1100) |
Kegg | Link to kegg annotations (Dmel_CG8416) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020969588.1) |
Pfam | ADP-ribosylation factor family (PF00025.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer