Protein coding transcript 130887

• Transcript: Ll_transcript_73779
• CDS coordinates: 2-409 (-)
• Peptide sequence: MAAITRHLTNRTPSISSLARRCLSSTLPSETNDCHAPPYSSFHLTPRVPPPDDLKNKHVQWVFLGCPGVGKGTYASRLSNLIGVPHIATGDLLREQLASSTSLSSQLSETVKQGQLVSDEVIINLLSNRLAAGEAK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_73779

• Blastp: Adenylate kinase 1, chloroplastic from Arabidopsis with 54.74% of identity
• Blastx: Adenylate kinase 1, chloroplastic from Arabidopsis with 54.74% of identity
• Eggnog: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism (By similarity)(COG0563)
• Kegg: Link to kegg annotations (AT2G37250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462171.1)
• Pfam: Adenylate kinase (PF00406.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;