Protein coding transcript 130889

• Transcript: Ll_transcript_62935
• CDS coordinates: 1-336 (+)
• Peptide sequence: DELVMFMAQVAHCYPGELANFAQELTNMLQTHGPVLDKDMRMTFCRALILLRNKRLLTPTDLLSLFFGLLRSQDKELRKFLESHIVSDIKNLNSKHKDAKLNRNLQNFMYTM
• ORF Type: internal

Annotations of Ll_transcript_62935

• Blastp: Protein SDA1 homolog from Nematostella with 63.06% of identity
• Blastx: Protein SDA1 homolog from Nematostella with 63.06% of identity
• Eggnog: SDA1 domain containing 1(ENOG410XPHI)
• Kegg: Link to kegg annotations (NEMVE_v1g106150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004502377.1)
• Pfam: NUC130/3NT domain (PF08158.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;