Protein coding transcript 130891

• Transcript: Ll_transcript_69836
• CDS coordinates: 1-489 (+)
• Peptide sequence: GKPFGENERDKWYILGAAAAIAFLGTVTMWEMGYKEIGWKEFVHTYLARGIVEKLEVVNKKWVRVRLMPGNTVDGASVLWFNIGSVDSFERNLENAQIEMNVEPPNFVPVIYKTEIEAASLSGMLPTILVIGFLIYMMRRSAEMMGGKKGRKGGLFGGVMEST
• ORF Type: internal

Annotations of Ll_transcript_69836

• Blastp: AFG3-like protein 2 from Homo with 53.08% of identity
• Blastx: AFG3-like protein 2 from Mus with 57.01% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (10939)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004507174.1)
• Pfam: FtsH Extracellular (PF06480.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;