Protein coding transcript 130892

• Transcript: Ll_transcript_69835
• CDS coordinates: 97-918 (+)
• Peptide sequence: MLSRLALRSELFRVAPLCANVVRTTQTKPAVTSTNESIIVPGFPKPNGLPQPNPFDGPERDLVNFPRMVRLEEPAKTRYLFVPEEWFEVFYKKTGVTGPYVLAAGITTYVLSKEIWVVEHEFPYVLATIGLFYVGWKKFGASLAGFLDKEIDEYEASCNASRKGEIDGLTESIENQKKEVWRTEAQKHVIQAKRENVAIQLEAIYRERALQAYNQVKRRLDYQLDLANLTRTVQQRHMVNWIIENVLKSLTNEQEKQSFKKCMVDLQALAAKA*
• ORF Type: complete

Annotations of Ll_transcript_69835

• Blastp: ATP synthase subunit b, mitochondrial from Sophophora with 47.09% of identity
• Blastx: ATP synthase subunit b, mitochondrial from Sophophora with 47.09% of identity
• Eggnog: atp synthase(ENOG410ZUQH)
• Kegg: Link to kegg annotations (Dmel_CG8189)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016174484.1)
• Pfam: Mitochondrial ATP synthase B chain precursor (ATP-synt_B) (PF05405.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;