Protein coding transcript 130893

• Transcript: Ll_transcript_69832
• CDS coordinates: 2-454 (+)
• Peptide sequence: FINHNFSQQVLKTNEARFKFNEPNPFITDEEGEVASVAYRYRKWDLGGGVVLVCRCEHDAVMTGPNGETQFITIKALNEWDSKLSGGVEWRQKLDTQRGAVLANELRNNACKLAKWTVQALLAGSDQVKFGYVSRAHVRDSSKHVILGTQQ
• ORF Type: internal

Annotations of Ll_transcript_69832

• Blastp: Eukaryotic translation initiation factor 3 subunit D from Nasonia with 85.53% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit D from Nasonia with 85.53% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG410XP1E)
• Kegg: Link to kegg annotations (100122367)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015943049.1)
• Pfam: Eukaryotic translation initiation factor 3 subunit 7 (eIF-3) (PF05091.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;