Protein coding transcript 130896

• Transcript: Ll_transcript_175675
• CDS coordinates: 2-478 (+)
• Peptide sequence: VAIMPSPMKKVRKCTEENVLAFSKLTEHGFQPTKGSEHAAGYDLRSAYSYVVKAHGKELIKTDIQIKVPQGTYGRVAPRSGLAWKNFIHVGAGVIDSDYRGNVGVILYNHSDEDFIVNKGDRVAQLICEMIVYPEVVEFKTLDETDRGEGGFGSTGTN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_175675

• Blastp: Deoxyuridine 5'-triphosphate nucleotidohydrolase from Rattus with 61.59% of identity
• Blastx: Deoxyuridine 5'-triphosphate nucleotidohydrolase from Rattus with 60% of identity
• Eggnog: This enzyme is involved in nucleotide metabolism it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA (By similarity)(COG0756)
• Kegg: Link to kegg annotations (497778)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460981.1)
• Pfam: dUTPase (PF00692.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;