Protein coding transcript 130902

• Transcript: Ll_transcript_3203
• CDS coordinates: 1-318 (+)
• Peptide sequence: VEITVSSDSAKVDVVDPALRQLPIERMMTPHVLVNIGGNKQICEFCEYFLHYVQTEMAAEKTVEKAKSVVEKACSRLPKTIEVQCKDFVDAYGNAFIAILVQEIDP
• ORF Type: internal

Annotations of Ll_transcript_3203

• Blastp: Prosaposin from Homo with 34.38% of identity
• Blastx: Prosaposin from Homo with 34.38% of identity
• Eggnog: surfactant protein B(ENOG410XSI5)
• Kegg: Link to kegg annotations (5660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003541325.1)
• Pfam: Saposin-like type B, region 1 (PF05184.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;