Protein coding transcript 130909

• Transcript: Ll_transcript_175242
• CDS coordinates: 48-386 (+)
• Peptide sequence: MDESKVEEMDEKIYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLQKVCMYFTYKIRYTNSSTEIPEFNIAPEIALELLMAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_175242

• Blastp: Elongin-C from Rattus with 95.19% of identity
• Blastx: Elongin-C from Rattus with 95.19% of identity
• Eggnog: Transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)(ENOG41123WR)
• Kegg: Link to kegg annotations (64525)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013456162.1)
• Pfam: Skp1 family, tetramerisation domain (PF03931.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;