Protein coding transcript 130910

• Transcript: Ll_transcript_175224
• CDS coordinates: 2-388 (+)
• Peptide sequence: SDIMSIIATTSGVAIFTAGTCVGAVSAIFLSKFRAKPKDQSWENGQEEKFEFEDANDEYRLIMGVRNDLKMQKGKVAAQCGHAAVAAYAKALKQKPKVLKNWLRYGSTKIAVRLDSEEELINLDKIARQ
• ORF Type: internal

Annotations of Ll_transcript_175224

• Blastp: Probable peptidyl-tRNA hydrolase 2 from Sophophora with 52.86% of identity
• Blastx: Probable peptidyl-tRNA hydrolase 2 from Sophophora with 52.86% of identity
• Eggnog: The natural substrate for this enzyme may be peptidyl- tRNAs which drop off the ribosome during protein synthesis (By similarity)(COG1990)
• Kegg: Link to kegg annotations (Dmel_CG1307)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001276301.2)
• Pfam: Peptidyl-tRNA hydrolase PTH2 (PF01981.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;