Protein coding transcript 130914

• Transcript: Ll_transcript_61947
• CDS coordinates: 2-346 (-)
• Peptide sequence: MGFHSIGNLQLTPLSAAATAVDSDDLEDVRLLDSYDTDDVSDSKIDEGMKRIQVRVTGMTCAACSNSVESALKSVNGVLTASVALLQNKADVVFDPTLLKDEDIKNAIEDAGFEA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_61947

• Blastp: Copper-transporting ATPase RAN1 from Arabidopsis with 62.07% of identity
• Blastx: Copper-transporting ATPase RAN1 from Arabidopsis with 62.07% of identity
• Eggnog: p-type ATPase(COG2217)
• Kegg: Link to kegg annotations (AT5G44790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439333.1)
• Pfam: Heavy-metal-associated domain (PF00403.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;